RetrogeneDB ID: | retro_ocun_548 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 12:20472838..20473129(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS25 | ||
| Ensembl ID: | ENSOCUG00000017256 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S25 [Source:HGNC Symbol;Acc:10413] |
| Percent Identity: | 56.31 % |
| Parental protein coverage: | 79.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | SAKKDKDPVNKSG-GKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVS-ERLKIRGS |
| .AKKDKD.VNKSG....K....S.....DKL....L......D..CKEVPNY....PAVVS..R..I... | |
| Retrocopy | AAKKDKDLVNKSG<ARPKALLRSSDRILDKLTQACLTKLLRTD--CKEVPNYTSTLPAVVS<LRKMISNF |
| Parental | LARA-ALQEL-LSKGLIKLVSKHRAQVIYTRNT |
| LARA..LQE..L.K.L.KLVSKHRAQVIYTRNT | |
| Retrocopy | LARA<TLQEKPLRKYLSKLVSKHRAQVIYTRNT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .17 RPM | 91 .94 RPM |
| SRP017611_kidney | 0 .10 RPM | 219 .64 RPM |
| SRP017611_liver | 0 .00 RPM | 69 .44 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000027772 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000013691 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007880 | 7 retrocopies | |
| Homo sapiens | ENSG00000118181 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025540 | 7 retrocopies | |
| Latimeria chalumnae | ENSLACG00000017531 | 4 retrocopies | |
| Macropus eugenii | ENSMEUG00000014185 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000009927 | 15 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000017256 | 11 retrocopies | |
| Otolemur garnettii | ENSOGAG00000007265 | 3 retrocopies | |
| Ochotona princeps | ENSOPRG00000016194 | 9 retrocopies | |
| Pongo abelii | ENSPPYG00000025915 | 6 retrocopies | |
| Pan troglodytes | ENSPTRG00000004361 | 10 retrocopies | |
| Sorex araneus | ENSSARG00000002284 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000010244 | 16 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005422 | 15 retrocopies | |
| Vicugna pacos | ENSVPAG00000000266 | 4 retrocopies |