RetrogeneDB ID: | retro_ocun_406 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 1:153052735..153052936(-) | ||
| Located in intron of: | ENSOCUG00000015212 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CCDC169 | ||
| Ensembl ID: | ENSOCUG00000026427 | ||
| Aliases: | None | ||
| Description: | coiled-coil domain containing 169 [Source:HGNC Symbol;Acc:34361] |
Retrocopy-Parental alignment summary:
>retro_ocun_406
GTGGGGGAGGGAAGAGGTGAAAACTTCACAACGTGAGCACCGACTGCCTTACACTGGAGTTGCTGGAAGAAATCCAGTGG
AGAGGATCATGCAACTCTCAATGCTTGGAACGAGATACAAGATAGCAGAACCGGAAGCCAGCTTCAGTGGTGACAAGAAA
GTGGCGAGTGGAAAGCTCCCCAGGAGACACAACTTGAACTG
ORF - retro_ocun_406 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 64.79 % |
| Parental protein coverage: | 59.13 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
Retrocopy - Parental Gene Alignment:
| Parental | MGEGRGENFD-GVSTDRLKLELLEEIHMKD-IVQLSMLEIRHKIAELEAKLKGD-DEGGEWKIRYETQLE |
| .GEGRGENF...VSTD.L.LELLEEI.....I.QLSML..R.KIAE.EA...GD..E.GEWK...ETQLE | |
| Retrocopy | VGEGRGENFT<NVSTDCLTLELLEEIQWRG<IMQLSMLGTRYKIAEPEASFSGD<QESGEWKAPQETQLE |
| Parental | L |
| L | |
| Retrocopy | L |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
Oryctolagus cuniculus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_ocun_406 retrocopy.
Oryctolagus cuniculus was not studied using FANTOM5 data.
retro_ocun_406 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_ocun_406 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 5 parental genes, and 5 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004615 | 1 retrocopy | |
| Equus caballus | ENSECAG00000011446 | 1 retrocopy | |
| Felis catus | ENSFCAG00000008786 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000026427 | 1 retrocopy |
retro_ocun_406 ,
|
| Sus scrofa | ENSSSCG00000026564 | 1 retrocopy |