RetrogeneDB ID: | retro_mputfur_1460 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897145.1:2174377..2174575(-) | ||
| Located in intron of: | ENSMPUG00000000103 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TGIF2-C20orf24 | ||
| Ensembl ID: | ENSMPUG00000017777 | ||
| Aliases: | None | ||
| Description: | TGIF2-C20orf24 readthrough [Source:HGNC Symbol;Acc:44664] |
| Percent Identity: | 82.35 % |
| Parental protein coverage: | 51.16 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | SVWSKVLRSDAAWEDKDEFLDVIYWFRQIIAVVLGVIWGVL-PLRGFLGIAGFC-LINAGVLYLYFSN |
| SVWSKVL.SDAAWEDKDEFLD.I.WF.QII.VVLGVIWGVL.PL.GFLGIAGFC.LI.AGVL.L..SN | |
| Retrocopy | SVWSKVLQSDAAWEDKDEFLDTIRWFQQIIPVVLGVIWGVL>PL*GFLGIAGFC<LISAGVLDL*CSN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000021805 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000011435 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017777 | 1 retrocopy |
retro_mputfur_1460 ,
|
| Otolemur garnettii | ENSOGAG00000000891 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000020317 | 1 retrocopy |