RetrogeneDB ID: | retro_mmul_2269 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:144600337..144600608(-) | ||
| Located in intron of: | ENSMMUG00000022124 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMMUG00000001195 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 73.91 % |
| Parental protein coverage: | 81.98 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | DEVFGFMCHVTAEVPSHDAMPGGIVLLVWFIMNNSRNVLLYVVFLQRLSSALHRVLLHLFRHVRIFDHGL |
| .EVFGFMC.VT.EVP.HDAM..G.V.LV.F....S.NVLL.VVFLQRLSS.LH.VLLHLFRHVRIFDHGL | |
| Retrocopy | NEVFGFMCWVTTEVPPHDAMSCGVVHLVIFLLDMSHNVLLFVVFLQRLSSTLH*VLLHLFRHVRIFDHGL |
| Parental | SVAH-VSHRGEGGWPTATVSWG |
| .V.H.V.H.GEGG.PTA.VSWG | |
| Retrocopy | LVTH>VTH-GEGG*PTAAVSWG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .34 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .24 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .39 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .12 RPM |
| SRP007412_kidney | 0 .12 RPM | 0 .12 RPM |
| SRP007412_liver | 0 .04 RPM | 0 .04 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .34 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Gorilla gorilla | retro_ggor_1113 |
| Pongo abelii | retro_pabe_1198 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000009268 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008793 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000001195 | 6 retrocopies |
retro_mmul_1463, retro_mmul_1723, retro_mmul_1897, retro_mmul_2269 , retro_mmul_470, retro_mmul_835,
|
| Pongo abelii | ENSPPYG00000005032 | 6 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008820 | 3 retrocopies |