RetrogeneDB ID: | retro_mmul_1379 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 19:51556736..51557095(+) | ||
| Located in intron of: | ENSMMUG00000022930 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF5AL1 | ||
| Ensembl ID: | ENSMMUG00000006206 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 5A-like 1 [Source:HGNC Symbol;Acc:17419] |
| Percent Identity: | 77.69 % |
| Parental protein coverage: | 65.22 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | GRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQD |
| G..CK.VEMST.KTGKH.HAKV.LV..DIFT.KKY.D.C.ST.N.DVPNIKRNDFQL.GIQ.GY.SLLQD | |
| Retrocopy | GLTCKMVEMSTCKTGKHSHAKVQLVVTDIFTRKKYKDNCLSTYNVDVPNIKRNDFQLLGIQGGYPSLLQD |
| Parental | SGEVREDLRLPE-GDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK |
| ..EV.EDL.LPE.GDLGKEIEQKY.CGE..LITVLSAMT.EAAVA.KAMAK | |
| Retrocopy | IREVQEDLLLPE<GDLGKEIEQKYNCGEGPLITVLSAMT*EAAVAVKAMAK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 52 .55 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 87 .50 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 57 .02 RPM |
| SRP007412_heart | 0 .12 RPM | 76 .61 RPM |
| SRP007412_kidney | 0 .00 RPM | 80 .87 RPM |
| SRP007412_liver | 0 .08 RPM | 149 .23 RPM |
| SRP007412_testis | 0 .04 RPM | 139 .16 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2004 |
| Gorilla gorilla | retro_ggor_1448 |
| Pongo abelii | retro_pabe_1640 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000132507 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012032 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000006206 | 1 retrocopy |
retro_mmul_1379 ,
|
| Macaca mulatta | ENSMMUG00000022880 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000006652 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007907 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000016478 | 3 retrocopies |