RetrogeneDB ID: | retro_mmul_1145 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 15:44200910..44201333(+) | ||
| Located in intron of: | ENSMMUG00000007724 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LAGE3 | ||
| Ensembl ID: | ENSMMUG00000007739 | ||
| Aliases: | None | ||
| Description: | L antigen family, member 3 [Source:HGNC Symbol;Acc:26058] |
| Percent Identity: | 84.4 % |
| Parental protein coverage: | 98.6 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EAEADAGGGADGGDGQGGHSFPGGADTAAAPASGAPPPHAPGPGRDAASAARGPGMRPHIFTLSVPFPTP |
| .A.ADAGG....GD.QG.HS.PGGADTAAAPA.GAPPPHA.GPGRDA.S.ARGPGMRPH.FTLSVPFPTP | |
| Retrocopy | DADADAGGSTNCGDSQGDHSCPGGADTAAAPAGGAPPPHASGPGRDAKSVARGPGMRPHVFTLSVPFPTP |
| Parental | LEAEIAHGSLAPDAEPHQRVVGKELTVSGRILAIRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVS |
| LEAEIA.GSLAPDAEPHQRVVGK.L.VSGRILA.RW.AEDCRLLRISVINFLD.LSLVV.TMQ.FGPPVS | |
| Retrocopy | LEAEIARGSLAPDAEPHQRVVGKNLAVSGRILAVRWEAEDCRLLRISVINFLDHLSLVVQTMQHFGPPVS |
| Parental | R |
| R | |
| Retrocopy | R |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .11 RPM | 5 .27 RPM |
| SRP007412_brain_prefrontal_cortex | 1 .59 RPM | 14 .04 RPM |
| SRP007412_cerebellum | 0 .19 RPM | 2 .78 RPM |
| SRP007412_heart | 0 .65 RPM | 3 .71 RPM |
| SRP007412_kidney | 0 .23 RPM | 6 .46 RPM |
| SRP007412_liver | 4 .28 RPM | 10 .05 RPM |
| SRP007412_testis | 11 .91 RPM | 1 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000024143 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000009093 | 1 retrocopy | |
| Homo sapiens | ENSG00000196976 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013507 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007739 | 1 retrocopy |
retro_mmul_1145 ,
|
| Mus musculus | ENSMUSG00000015289 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000014285 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000003778 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000020881 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000037249 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000025528 | 1 retrocopy |