RetrogeneDB ID: | retro_meug_905 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold2262:47806..48007(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GABARAPL3 | ||
| Ensembl ID: | ENSMEUG00000002873 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptors associated protein like 3, pseudogene [Source:HGNC Symbol;Acc:4069] |
| Percent Identity: | 65.22 % |
| Parental protein coverage: | 58.97 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIH |
| MK...K..HPF....KEG.KI..KYPD.VPVIVEKAP..RVPDLDK..YL.PSDLTVG...FLI.K..H | |
| Retrocopy | MKL*HKQGHPF*CWTKEGKKIWNKYPDKVPVIVEKAPNTRVPDLDKWEYLMPSDLTVG--WFLIQKWTH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Equus caballus | ENSECAG00000014832 | 1 retrocopy | |
| Homo sapiens | ENSG00000139112 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022360 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002873 | 3 retrocopies |
retro_meug_1584, retro_meug_1840, retro_meug_905 ,
|
| Sarcophilus harrisii | ENSSHAG00000007434 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002246 | 1 retrocopy |