RetrogeneDB ID: | retro_mdom_980 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 3:109651762..109652176(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000001832 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.87 % |
| Parental protein coverage: | 57.2 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MSRPVRNRKVVDYSQFQESDDADEDYGRDSAPPAKKIRSSPREAKNKRRSGKNSQEDSEDSEEKDVKTKK |
| MS...RNRKVVDYSQFQE.DDAD.DYGRDSA.P.KKI..SPRE.KNKRRS.............K...... | |
| Retrocopy | MSQFIRNRKVVDYSQFQEFDDADKDYGRDSASPTKKIEASPRETKNKRRSXXXXHRKIVRTLNKKYVRTE |
| Parental | DDSHSPEDSEDEKEDHKNVRQQRQAASKAASKQREMLMEDVGSEEEQEEEEEAPFQEKDSGSDEDFLME |
| .D............DHKNV.QQ..AASKA.SKQREMLMEDVGS..EQE..EEAPFQEKDS.SD.DFL.E | |
| Retrocopy | KDDSH*PEDNEYEKDHKNVHQQQ*AASKAVSKQREMLMEDVGS-KEQEDKEEAPFQEKDSRSDKDFLLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012950 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008001 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001855 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017212 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000003183 | 1 retrocopy | |
| Homo sapiens | ENSG00000069275 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000026655 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000007829 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000005645 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000001832 | 1 retrocopy |
retro_mdom_980 ,
|
| Nomascus leucogenys | ENSNLEG00000014564 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001904 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000047287 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000015641 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000000910 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000003751 | 1 retrocopy |