RetrogeneDB ID: | retro_mdom_1699 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 6:271625502..271625734(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000013617 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_mdom_1699
CTGAAAGCACCTCCCGCCTTTGAGTCCTTCCACCTCTTTGAAGGAAAGAATGTTACTATCTGCAAGGACACTGTGGTACC
CAATGCCTGTTTGTTCACCATCAACAGTGAGGACTACACACTAGGAAACGTCATCAAATCACATTTTACTGAAAGACCCG
CAGGTGCTGTTTGCAGACGATAAAGACCTCTACCCACTGGAACACAGCATCATCATTCCTGTACAGACCACA
ORF - retro_mdom_1699 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 74.68 % |
| Parental protein coverage: | 60.94 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQ-LLKDPQVLFAGYKVPHPLEH |
| ..APPAFESF.LFEG.K..TI.KDT.VPNACLFTIN.ED.TLGN.IKS..LLKDPQVLFA..K...PLEH | |
| Retrocopy | LKAPPAFESFHLFEG-KNVTICKDTVVPNACLFTINSEDYTLGNVIKSH>LLKDPQVLFADDKDLYPLEH |
| Parental | KIIIRVQTT |
| .III.VQTT | |
| Retrocopy | SIIIPVQTT |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Monodelphis domestica was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mdom_1699 retrocopy.
Monodelphis domestica was not studied using FANTOM5 data.
retro_mdom_1699 was not experimentally validated.
Retrocopy orthology:
Monodelphis domestica does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 2 parental genes, and 3 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Monodelphis domestica | ENSMODG00000013617 | 2 retrocopies |
retro_mdom_1699 , retro_mdom_1927,
|
| Sus scrofa | ENSSSCG00000024080 | 1 retrocopy |