RetrogeneDB ID: | retro_lafr_574 | ||
Retrocopy location | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_22:22937784..22937996(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ARPP19 | ||
| Ensembl ID: | ENSLAFG00000000755 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.11 % |
| Parental protein coverage: | 63.39 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | MSAEIPEAAS-VEEQKEMED-KVTNPEKAEEAKLKARYPHLGQKP-GGSDFLRKRLQKGQKYFDSGDYNM |
| MS.EI.E..S...EQKEM.........KAEEAKLKARYPHL.QKP...SD.LRK.LQKG.....S.DY.. | |
| Retrocopy | MSVEIFEVPS<KKEQKEMKE<EGISTVKAEEAKLKARYPHLVQKP>*NSDSLRKQLQKG*INLYSRDYDV |
| Parental | AKAK |
| .KAK | |
| Retrocopy | SKAK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000011321 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000025250 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000755 | 2 retrocopies |
retro_lafr_1058, retro_lafr_574 ,
|
| Loxodonta africana | ENSLAFG00000011261 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013865 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006487 | 2 retrocopies |