RetrogeneDB ID: | retro_lafr_363 | ||
Retrocopy location | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_13:58250073..58250271(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PFDN6 | ||
| Ensembl ID: | ENSLAFG00000012967 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 90.91 % |
| Parental protein coverage: | 51.16 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | LIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQEL |
| LI.KKLQG.VEKYQQLQKDLSKSMSGRQKLEAQLTENN.VK.ELALLDGSN..FKLLGPVLVKQEL | |
| Retrocopy | LI*KKLQGQVEKYQQLQKDLSKSMSGRQKLEAQLTENNVVKGELALLDGSNLAFKLLGPVLVKQEL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000011211 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000012967 | 1 retrocopy |
retro_lafr_363 ,
|
| Macropus eugenii | ENSMEUG00000016778 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028341 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000000983 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000006019 | 1 retrocopy |