RetrogeneDB ID: | retro_itri_1458 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393493.1:133219..133449(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LRRFIP2 | ||
| Ensembl ID: | ENSSTOG00000023775 | ||
| Aliases: | None | ||
| Description: | leucine rich repeat (in FLII) interacting protein 2 [Source:HGNC Symbol;Acc:6703] |
| Percent Identity: | 59.49 % |
| Parental protein coverage: | 54.93 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | LDEKSDKQYAENYTRPSSRNSASATT-PLSGNSSRRGSGDTSSLIDPDTSLSELRESLSEVEEKYKKAMV |
| LDEK.DK..AEN.TRPSS.NSA.A....LSGNSSR.GSGDT.S.IDPDTSL.EL...L.....K.KK..V | |
| Retrocopy | LDEKPDKL*AENDTRPSS*NSALAAN<SLSGNSSR*GSGDTNSFIDPDTSLTELP*CLKH-RKKSKKGIV |
| Parental | SNAQLDNEK |
| ....L..E. | |
| Retrocopy | FSEHLNQEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Macaca mulatta | ENSMMUG00000022539 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000023775 | 1 retrocopy |
retro_itri_1458 ,
|