RetrogeneDB ID: | retro_itri_1408 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393479.1:276885..277125(+) | ||
| Located in intron of: | ENSSTOG00000004575 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | IL21 | ||
| Ensembl ID: | ENSSTOG00000012108 | ||
| Aliases: | None | ||
| Description: | interleukin 21 [Source:HGNC Symbol;Acc:6005] |
Retrocopy-Parental alignment summary:
>retro_itri_1408
TGTCTGATAGTCATCTTCCTGGGGATAGGGGCCCATGAATAAAGTTCCCAAGGGCAAAATCATTGCCTCATGATTAGAAT
GCGTCACCTTACAGACACTGTGGACCAGTTGAAAAGTTATATGGATGATTTGGACCCTGAATTTCCACCAACTCCACAAG
ATGTAAAGGGGCACTGTGAGCAATCAGCTTTTTCAAGTTTTCAGAAGGACCAACTAAAGTCAGCAAATGCAGGAGACAAC
ORF - retro_itri_1408 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 63.41 % |
| Parental protein coverage: | 55.03 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | CLMVILLGTVAHSSSSPGQDRRLMIRMRHLIHTVDQLKKYVNNLEPELLPAPQDVKGRCEQSALLCFQKF |
| CL.VI.LG..AH..SS.GQ...LMIRMRHL..TVDQLK.Y...L.PE..P.PQDVKG.CEQSA...FQK. | |
| Retrocopy | CLIVIFLGIGAHE*SSQGQNHCLMIRMRHLTDTVDQLKSYMDDLDPEFPPTPQDVKGHCEQSAFSSFQK- |
| Parental | AGQLKPPNTGDN |
| ..QLK..N.GDN | |
| Retrocopy | -DQLKSANAGDN |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Ictidomys tridecemlineatus was not studied using RNA-Seq expression data.
Ictidomys tridecemlineatus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_itri_1408 retrocopy.
Ictidomys tridecemlineatus was not studied using FANTOM5 data.
retro_itri_1408 was not experimentally validated.
Retrocopy orthology:
Ictidomys tridecemlineatus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ictidomys tridecemlineatus | ENSSTOG00000012108 | 1 retrocopy |
retro_itri_1408 ,
|