RetrogeneDB ID: | retro_itri_1244 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393411.1:1877138..1877426(+) | ||
| Located in intron of: | ENSSTOG00000015601 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DYNLRB1 | ||
| Ensembl ID: | ENSSTOG00000014820 | ||
| Aliases: | None | ||
| Description: | dynein, light chain, roadblock-type 1 [Source:HGNC Symbol;Acc:15468] |
| Percent Identity: | 94.79 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | QAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLR |
| .AEVEETLK.LQSQKG.QGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLR | |
| Retrocopy | EAEVEETLK*LQSQKGIQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLR |
| Parental | IRSKKNEIMVAPDKDYFLIVIQNPTE |
| I.SKKNE.MVAPDKDYFLIVIQNPTE | |
| Retrocopy | ICSKKNETMVAPDKDYFLIVIQNPTE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009179 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000007547 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000018199 | 10 retrocopies | |
| Equus caballus | ENSECAG00000008404 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000018637 | 2 retrocopies | |
| Felis catus | ENSFCAG00000002304 | 1 retrocopy | |
| Homo sapiens | ENSG00000125971 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023900 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000029820 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000003253 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004820 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000031253 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000010082 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000021027 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016802 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000010937 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013416 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014820 | 1 retrocopy |
retro_itri_1244 ,
|