RetrogeneDB ID:

retro_hsap_2887

Retrocopy
location
Organism:Human (Homo sapiens)
Coordinates:3:178977538..178979061(-)
Located in intron of:ENSG00000171121
Retrocopy
information
Ensembl ID:ENSG00000240429
Aliases:None
Status:KNOWN_PSEUDOGENE
Parental gene
information
Parental gene summary:
Parental gene symbol:LRRFIP1
Ensembl ID:ENSG00000124831
Aliases:LRRFIP1, FLAP-1, FLAP1, FLIIAP1, GCF-2, GCF2, HUFI-1, TRIP
Description:leucine rich repeat (in FLII) interacting protein 1 [Source:HGNC Symbol;Acc:6702]


Retrocopy-Parental alignment summary:






>retro_hsap_2887
TTGACCAGCCCCGCGGCCACGCAGAGCCGGGAGATCTACTGTTTGAGCGCGGAAGCGCAGAGGCTGGCGGAGGCCCGGCT
CGCCGCAAAACGGGAGGCCCGCGCGGAGGCTCGTGAGATCCCCATGAAGGAGCTGGAGCGGCAGCAGAAGGAGGTAGAAG
AGAGACCAGAAAAATATTTTACTGAGAAGGGGTCTCGTAACATGCTGGGCCCGTCTGCAGCCACGCTGGCCTTTCTGGGT
GGGACTTCCTCTCAGAGAGGCAGCGGAGACACCTCTATATCCATCGACACCGAGGCGTCCATCAGGGAAATCAAGGACTC
TCTAGCAGAAGTTGAAGAGAAATGTAAGAAGGCTATGTTTTCCAATGCTCAGTTAGACAATGAAAACACAAACTTCATTT
ACCAAGTTGACACCCTGAAAGATATGTTGCTGGAGATTGAAGAACAGCTGGCTGAATATAGGCGGCAGTACGAAGAGAAA
AACAAATAATTTGAAAGGGAAAAACACGCCCACAGTATACTGCAGTTTCAGTTTGCTGAAGTCAAGGAGGCCCTGAAGCA
AACAGAGGAAATGCTCGAGAAACATGGAATAATCCTAAATTCAGAAATAGTTACCAATGGAGAGACTTCCGACACTCTCA
GTAATGTTTGATACCAAGATCCTACCAAGATGACGAAAGAAGAGTTAAATGCCCTCAAGTCGACAGGGGATGGGACCCTA
GGAAAGCCAGTGAGGTGGAGGTGAAGAATGAAATCGTGGCGAATGTGGGGAAAAGAGAAATCTTGCACAATACTGAGAAA
GAACAACACACAGAGGACACAGTGAAGGATTGTGTGGACATAGAGGTATTCACTGCTGGTGAGAATACCGAGGACCAGAA
ATCCTCTGAAGACACTGCCCCATTCCTAGGAACCTTAGCAGGTGCTACCTATGAGGAACAGGTTCAAAGCCAAATTCTTG
AGAGCGCTTCTCTCCCTGAAAACACAGCACAGGTTGAGTCAAATGAGGTCATGGGTGCACCAGATGACAGGACCAGAACT
CCCCTTGAGCCATCCAACTGTTGGAGTGACTTAGATGGTGGGAGCCACACAGAGAATGTGGGAGAGGCAGCGGTGACTCA
GGTTGGAGAGCAGGCAGACACAGTGGCCTCATGTCCTTTAGGGCATAGTGATGACACAGTTTATCATGATGACAGATGTA
TGGTAGAGGTCCCCCAACAGTTAGAGACAAGCATAGGGCATAGTTTAGAGAAAGAATTCACCAACCAGGAAGCAGCTGAG
CCCAAGGAGGTTCCAGTGCAGAGTACAGAAGCAGGTAGGGATCACAACGAAGAAGAGGGTGAAGAAAAAGGATTAAGGGA
TGAGAAACCAATCAAGACAGAAGTTCCTGGTTCTCCAGCAGGAACTGAGAGCAAGGGTCAGGAGGCGACAGGTCCAAGTA
CAGTAGACACTCAAAGTGAACCCTCAGATATGAAAGAGCCAGATGAAGAAAAGAATGACCAACAGGGAGAGGCATTGGAC
TCA

ORF - retro_hsap_2887 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: 91.16 %
Parental protein coverage: 67.55 %
Number of stop codons detected: 2
Number of frameshifts detected: 1


Retrocopy - Parental Gene Alignment:

ParentalMTSPAAAQSREIDCLSPEAQKLAEARLAAKRAARAEAREIRMKELERQQKEVEERPEKDFTEKGSRNMPG
.TSPAA.QSREI.CLS.EAQ.LAEARLAAKR.ARAEAREI.MKELERQQKEVEERPEK.FTEKGSRNM.G
RetrocopyLTSPAATQSREIYCLSAEAQRLAEARLAAKREARAEAREIPMKELERQQKEVEERPEKYFTEKGSRNMLG
ParentalLSAATLASLGGTSSRRGSGDTSISIDTEASIREIKDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLK
.SAATLA.LGGTSS.RGSGDTSISIDTEASIREIKDSLAEVEEK.KKAM.SNAQLDNE.TNF.YQVDTLK
RetrocopyPSAATLAFLGGTSSQRGSGDTSISIDTEASIREIKDSLAEVEEKCKKAMFSNAQLDNENTNFIYQVDTLK
ParentalDMLLELEEQLAESRRQYEEKNKEFEREKHAHSILQFQFAEVKEALKQREEMLEKHGIILNSEIATNGETS
DMLLE.EEQLAE.RRQYEEKNK.FEREKHAHSILQFQFAEVKEALKQ.EEMLEKHGIILNSEI.TNGETS
RetrocopyDMLLEIEEQLAEYRRQYEEKNK*FEREKHAHSILQFQFAEVKEALKQTEEMLEKHGIILNSEIVTNGETS
ParentalDTLNNVGYQGPTKMTKEELNALKSTGDGTLGR-ASEVEVKNEIVANVGKREILHNTEKEQHTEDTVKDCV
DTL.NV.YQ.PTKMTKEELNALKSTGDGTLG..ASEVEVKNEIVANVGKREILHNTEKEQHTEDTVKDCV
RetrocopyDTLSNV*YQDPTKMTKEELNALKSTGDGTLGK<ASEVEVKNEIVANVGKREILHNTEKEQHTEDTVKDCV
ParentalDIEVFPAGENTEDQKSSEDTAPFLGTLAGATYEEQVQSQILESSSLPENTVQVESNEVMGAPDDRTRTPL
DIEVF.AGENTEDQKSSEDTAPFLGTLAGATYEEQVQSQILES.SLPENT.QVESNEVMGAPDDRTRTPL
RetrocopyDIEVFTAGENTEDQKSSEDTAPFLGTLAGATYEEQVQSQILESASLPENTAQVESNEVMGAPDDRTRTPL
ParentalEPSNCWSDLDGGNHTENVGEAAVTQVEEQAGTVASCPLGHSDDTVYHDDKCMVEVPQELETSTGHSLEKE
EPSNCWSDLDGG.HTENVGEAAVTQV.EQA.TVASCPLGHSDDTVYHDD.CMVEVPQ.LETS.GHSLEKE
RetrocopyEPSNCWSDLDGGSHTENVGEAAVTQVGEQADTVASCPLGHSDDTVYHDDRCMVEVPQQLETSIGHSLEKE
ParentalFTNQEAAEPKEVPAHSTEVGRDHNEEEGEETGLRDEKPIKTEVPGSPAGTEGNCQEATGPSTVDTQNEPL
FTNQEAAEPKEVP..STE.GRDHNEEEGEE.GLRDEKPIKTEVPGSPAGTE...QEATGPSTVDTQ.EP.
RetrocopyFTNQEAAEPKEVPVQSTEAGRDHNEEEGEEKGLRDEKPIKTEVPGSPAGTESKGQEATGPSTVDTQSEPS
ParentalDMKEPDEEKSDQQGEALDS
DMKEPDEEK.DQQGEALDS
RetrocopyDMKEPDEEKNDQQGEALDS

Legend:
*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide






(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)

Expression validation based on RNA-Seq data:
Library Retrocopy expression Parental gene expression
bodymap2_adipose 0 .44 RPM 132 .51 RPM
bodymap2_adrenal 1 .51 RPM 161 .54 RPM
bodymap2_brain 0 .80 RPM 58 .98 RPM
bodymap2_breast 0 .45 RPM 106 .42 RPM
bodymap2_colon 1 .01 RPM 255 .16 RPM
bodymap2_heart 0 .39 RPM 115 .53 RPM
bodymap2_kidney 0 .74 RPM 191 .46 RPM
bodymap2_liver 0 .38 RPM 57 .44 RPM
bodymap2_lung 0 .12 RPM 205 .85 RPM
bodymap2_lymph_node 1 .61 RPM 133 .87 RPM
bodymap2_ovary 0 .67 RPM 97 .39 RPM
bodymap2_prostate 1 .35 RPM 244 .72 RPM
bodymap2_skeletal_muscle 0 .55 RPM 95 .05 RPM
bodymap2_testis 1 .51 RPM 80 .48 RPM
bodymap2_thyroid 1 .22 RPM 143 .72 RPM
bodymap2_white_blood_cells 0 .18 RPM 428 .76 RPM
RNA Polymerase II activity may be related with retro_hsap_2887 in 31 libraries
ENCODE library ID Target ChIP-Seq Peak coordinates
ENCFF002CFW POLR2A 3:178979022..178979365
ENCFF002CFX POLR2A 3:178979023..178979349
ENCFF002CGN POLR2A 3:178979039..178979340
ENCFF002CHO POLR2A 3:178978909..178979402
ENCFF002CIO POLR2A 3:178979039..178979260
ENCFF002CJZ POLR2A 3:178979085..178979301
ENCFF002CKX POLR2A 3:178979027..178979299
ENCFF002CLM POLR2A 3:178978935..178979475
ENCFF002CMI POLR2A 3:178978864..178979410
ENCFF002COJ POLR2A 3:178979010..178979446
ENCFF002CQC POLR2A 3:178979024..178979321
ENCFF002CQE POLR2A 3:178979126..178979339
ENCFF002CQG POLR2A 3:178978945..178979469
ENCFF002CQI POLR2A 3:178979091..178979231
ENCFF002CQK POLR2A 3:178979007..178979326
ENCFF002CQM POLR2A 3:178979030..178979307
ENCFF002CQO POLR2A 3:178979040..178979296
ENCFF002CSY POLR2A 3:178979013..178979313
ENCFF002CUP POLR2A 3:178979026..178979342
ENCFF002CXM POLR2A 3:178978945..178979435
ENCFF002CXO POLR2A 3:178978980..178979404
ENCFF002CXP POLR2A 3:178979145..178979273
ENCFF002CXR POLR2A 3:178979075..178979297
ENCFF002DAH POLR2A 3:178979040..178979324
ENCFF002DBB POLR2A 3:178979056..178979256
ENCFF002DBE POLR2A 3:178979104..178979285
ENCFF002DBO POLR2A 3:178979059..178979301
ENCFF002DBP POLR2A 3:178979061..178979286
ENCFF002DBQ POLR2A 3:178979011..178979381
ENCFF002DBT POLR2A 3:178978998..178979368
ENCFF002CZW POLR2A 3:178978730..178979480
2 EST(s) were mapped to retro_hsap_2887 retrocopy
EST ID Start End Identity Match Mis-match Score
BE166271 178977783 178978103 95.3 304 9 290
DB281879 178977998 178978549 98.8 547 4 542


TSS No. TSS Name TSS expression level (Expr) in TPM range:
no expression 0 < Expr ≤ 1 1 < Expr ≤ 5 5 < Expr ≤ 10 Expr > 10
TSS #1 TSS_131962931 libraries 697 libraries 191 libraries 6 libraries 4 libraries
TSS #2 TSS_1319631128 libraries 611 libraries 86 libraries 2 libraries 2 libraries

The graphical summary, for retro_hsap_2887 TSS expression levels > 0 TPM .
TSS expression levels were studied across 1829 TSS-CAGE libraries, based on FANTOM5 data.
The expression values were visualized using beanplot. If you have any doubts, how to read it, read more in Kampstra P (2008)

retro_hsap_2887 was not experimentally validated.

Retrocopy orthology:
Retrocopy retro_hsap_2887 has 2 orthologous retrocopies within eutheria group .

Species RetrogeneDB ID
Gorilla gorilla retro_ggor_2001
Macaca mulatta retro_mmul_1455

Parental genes homology:
Parental genes homology involve 3 parental genes, and 3 retrocopies.

Species Parental gene accession Retrocopies number
Homo sapiens ENSG00000124831 1 retrocopy
retro_hsap_2887 ,
Gorilla gorilla ENSGGOG000000084111 retrocopy
Macaca mulatta ENSMMUG000000033861 retrocopy

Expression level across human populations :

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2089

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2112

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2135

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2158

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2181

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2204

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2227

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2250

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2273

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2296

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2325

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2348

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2371

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2394

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2417

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2440

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2463

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2486

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2509

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2532

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2553

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2576

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2599

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2622

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2645

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2668

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2691

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2714

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2737

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2760

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2787

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2810

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2837

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2860

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2887

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2910

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2937

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2960

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 2987

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3010

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3122

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3145

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3168

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3191

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3214

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3241

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3264

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3287

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3310

Notice: Undefined variable: populationsDictCols in /home/retrogenedb/www/retrogene_maps.php on line 3333

Notice: Undefined variable: populLEGEND in /home/retrogenedb/www/retrogene_maps.php on line 3353
image/svg+xml GBR_HG00142 GBR_HG00099 GBR_HG00114 GBR_HG00143 GBR_HG00131 GBR_HG00137 GBR_HG00133 GBR_HG00119 GBR_HG00111 GBR_HG00134 FIN_HG00378 FIN_HG00338 FIN_HG00349 FIN_HG00375 FIN_HG00315 FIN_HG00277 FIN_HG00328 FIN_HG00321 FIN_HG00377 FIN_HG00183 TSI_NA20756 TSI_NA20538 TSI_NA20798 TSI_NA20532 TSI_NA20765 TSI_NA20518 TSI_NA20513 TSI_NA20512 TSI_NA20771 TSI_NA20786 YRI_NA19114 YRI_NA19099 YRI_NA18870 YRI_NA18907 YRI_NA19223 YRI_NA19214 YRI_NA18916 YRI_NA19093 YRI_NA19118 YRI_NA19213 Toscaniin Italia: Finnish inFinland: British in England and Scotland: Utah Residents (CEPH) with Northernand Western European Ancestry: Yoruba in Ibadan, Nigeria: CEU_NA12760 CEU_NA12827 CEU_NA12872 CEU_NA12751 CEU_NA12873 CEU_NA12400 CEU_NA11930 CEU_NA12004 CEU_NA11831 CEU_NA11843



Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3372

Notice: Undefined variable: populationsDict in /home/retrogenedb/www/retrogene_maps.php on line 3375
Library Retrogene expression
CEU_NA11831 0 .00 RPM
CEU_NA11843 0 .00 RPM
CEU_NA11930 0 .00 RPM
CEU_NA12004 0 .00 RPM
CEU_NA12400 0 .00 RPM
CEU_NA12751 0 .00 RPM
CEU_NA12760 0 .00 RPM
CEU_NA12827 0 .00 RPM
CEU_NA12872 0 .00 RPM
CEU_NA12873 0 .00 RPM
FIN_HG00183 0 .00 RPM
FIN_HG00277 0 .00 RPM
FIN_HG00315 0 .00 RPM
FIN_HG00321 0 .00 RPM
FIN_HG00328 0 .00 RPM
FIN_HG00338 0 .00 RPM
FIN_HG00349 0 .00 RPM
FIN_HG00375 0 .00 RPM
FIN_HG00377 0 .00 RPM
FIN_HG00378 0 .00 RPM
GBR_HG00099 0 .00 RPM
GBR_HG00111 0 .00 RPM
GBR_HG00114 0 .00 RPM
GBR_HG00119 0 .00 RPM
GBR_HG00131 0 .00 RPM
GBR_HG00133 0 .00 RPM
GBR_HG00134 0 .00 RPM
GBR_HG00137 0 .00 RPM
GBR_HG00142 0 .00 RPM
GBR_HG00143 0 .00 RPM
TSI_NA20512 0 .00 RPM
TSI_NA20513 0 .00 RPM
TSI_NA20518 0 .00 RPM
TSI_NA20532 0 .00 RPM
TSI_NA20538 0 .00 RPM
TSI_NA20756 0 .00 RPM
TSI_NA20765 0 .00 RPM
TSI_NA20771 0 .00 RPM
TSI_NA20786 0 .00 RPM
TSI_NA20798 0 .00 RPM
YRI_NA18870 0 .00 RPM
YRI_NA18907 0 .00 RPM
YRI_NA18916 0 .00 RPM
YRI_NA19093 0 .00 RPM
YRI_NA19099 0 .00 RPM
YRI_NA19114 0 .00 RPM
YRI_NA19118 0 .00 RPM
YRI_NA19213 0 .00 RPM
YRI_NA19214 0 .00 RPM
YRI_NA19223 0 .00 RPM
Could not execute MySQL populData: