RetrogeneDB ID: | retro_fcat_427 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A3:61450254..61450477(+) | ||
| Located in intron of: | ENSFCAG00000026430 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CDKL2 | ||
| Ensembl ID: | ENSFCAG00000025744 | ||
| Aliases: | None | ||
| Description: | cyclin-dependent kinase-like 2 (CDC2-related kinase) [Source:HGNC Symbol;Acc:1782] |
Retrocopy-Parental alignment summary:
>retro_fcat_427
CCTCAACTAAAGTATAATCATCTCCCTCAGTTAAGAGCCTTGGAAGGTGTGGTTCAGAATTCCAGCCTAATAAGGAAAAA
GAACAAAAATCTTTCAGACTCTTCAAATTCCTTCTTTGGCCTCTACTGACTTGTGTGCCCCCAGTATAGCATTACAGCCA
ATATCAAGATCTCCACCATCAGACGATTCGGAGGCTGATCTGCTTTGAATGGAACACCAGCAC
ORF - retro_fcat_427 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 70.67 % |
| Parental protein coverage: | 96.1 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | PELNYNHLPELRALEGIARNSRLIRKENKNLSES-RIPSLATIDLHAPSIGLHQVSGSPLSDDSEADLPR |
| P.L.YNHLP.LRALEG...NS.LIRK.NKNLS.S..IPSLA..DL.APSI.L...S.SP.SDDSEADL.. | |
| Retrocopy | PQLKYNHLPQLRALEGVVQNSSLIRKKNKNLSDS>QIPSLASTDLCAPSIALQPISRSPPSDDSEADLL* |
| Parental | MEHQH |
| MEHQH | |
| Retrocopy | MEHQH |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .23 RPM | 68 .06 RPM |
| SRP017611_kidney | 0 .21 RPM | 43 .28 RPM |
| SRP017611_liver | 0 .20 RPM | 0 .00 RPM |
Felis catus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_fcat_427 retrocopy.
Felis catus was not studied using FANTOM5 data.
retro_fcat_427 was not experimentally validated.
Retrocopy orthology:
Felis catus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Felis catus | ENSFCAG00000025744 | 1 retrocopy |
retro_fcat_427 ,
|