RetrogeneDB ID: | retro_fcat_1939 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | X:97028630..97028839(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM218 | ||
| Ensembl ID: | ENSFCAG00000015332 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 218 [Source:HGNC Symbol;Acc:27344] |
Retrocopy-Parental alignment summary:
>retro_fcat_1939
TGCGGGCTGCTATCCAGAGCCTCTGCAGTAGCCAGGTTCCCTGTCATGTATTTACTCCTCGGTGCTCCCATCATCAGTTC
AGTTCTGCCGCTCTTCCCTGAGCTGGGCAAGCCTCAGCCGCAGGGGTCGAAACGAAGGCTGTGGATGCGTCCTTCATCGG
CTGCTGCGTCCCGCTGGCTTTGCTCACCGCTGTCTTCCTCGGAGGTCTC
ORF - retro_fcat_1939 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 61.97 % |
| Parental protein coverage: | 60.87 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | CVLLSRASGVARFSVIFVFLGALIITSVLLVFPR-ASEVPAPEVEMKIVDSFFIGRYVLLAFLTAVFLGG |
| C.LLSRAS.VARF.V....LGA.II.SVL..FP..A....A..VE.K.VD..FIG..V.LA.LTAVFLGG | |
| Retrocopy | CGLLSRASAVARFPVMYLLLGAPIISSVLPLFPE<AGQASAAGVETKAVDASFIGCCVPLALLTAVFLGG |
| Parental | L |
| L | |
| Retrocopy | L |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 6 .60 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .01 RPM |
Felis catus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_fcat_1939 retrocopy.
Felis catus was not studied using FANTOM5 data.
retro_fcat_1939 was not experimentally validated.
Retrocopy orthology:
Felis catus does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 2 parental genes, and 2 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000012586 | 1 retrocopy | |
| Felis catus | ENSFCAG00000015332 | 1 retrocopy |
retro_fcat_1939 ,
|