RetrogeneDB ID: | retro_etel_2180 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_91581:492..734(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSETEG00000006509 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSETEG00000019179 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_etel_2180
CTGAACACTCTCCAACTTTTAACCCTCTTGTTGTTTTGTTTCTTTGTTTTTGGTGGGCTCCCCCAACTATCATTCAAGAA
CTGGGCTGCCGCCTTTGTCACCAGCAACCACTTGTTGGCAAGAGACAGGAACTTCTCTACAGTCGCTCTGTCGGTTCCCG
GGTCATAGAAAGCATTCTATATGCAGCTTTGGCTGCTGGGCCCCTTGAATCTCGCAGGTCTTGGTCTTTGAGCCATGAAG
CT
ORF - retro_etel_2180 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 50.6 % |
| Parental protein coverage: | 97.59 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
Retrocopy - Parental Gene Alignment:
| Parental | LNIQRLLNLWAFFVYSNRASPQPVVRN-AAAFFTGNLLLARDRNLLTKSVLWLPGPYKEFCMK-ALAACC |
| LN...LL.L..F........PQ....N.AAAF.T.N.LLARDRN..T...L..PG..K.F.M..ALAA.. | |
| Retrocopy | LNTLQLLTLLLFCFFVFGGLPQLSFKNWAAAFVTSNHLLARDRNFSTVA-LSVPGS*KAFYMQ<ALAAGP |
| Parental | RESLRSWSLSLRA |
| .ES.RSWSLS..A | |
| Retrocopy | LESRRSWSLSHEA |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Echinops telfairi was not studied using RNA-Seq expression data.
Echinops telfairi was not studied using ChIP-Seq data.
Echinops telfairi was not studied using EST data.
Echinops telfairi was not studied using FANTOM5 data.
retro_etel_2180 was not experimentally validated.
Retrocopy orthology:
Echinops telfairi does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000019179 | 1 retrocopy |
retro_etel_2180 ,
|