RetrogeneDB ID: | retro_etel_2114 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_64775:3155..3383(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSETEG00000008917 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PLEKHJ1 | ||
| Ensembl ID: | ENSETEG00000017943 | ||
| Aliases: | None | ||
| Description: | pleckstrin homology domain containing, family J member 1 [Source:HGNC Symbol;Acc:18211] |
| Percent Identity: | 88.16 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MRYNEKELQALSRQPADMAAELGMRVPKKGSVVKRRLIKLVANFLFYFRTHEAEPIGAWLLEHCRVTRED |
| ..Y.EKELQALSRQPADMAAELG.RVPK.GSVVKR.LIKLVANFLFYFRTHEAEPIGA.LLEHCRVTRE. | |
| Retrocopy | LHYKEKELQALSRQPADMAAELGLRVPKEGSVVKRWLIKLVANFLFYFRTHEAEPIGALLLEHCRVTREE |
| Parental | PS-FSI |
| PS.FSI | |
| Retrocopy | PSAFSI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000017943 | 1 retrocopy |
retro_etel_2114 ,
|