RetrogeneDB ID: | retro_etel_1773 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_293889:112204..112444(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM159 | ||
| Ensembl ID: | ENSETEG00000007187 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 159 [Source:HGNC Symbol;Acc:30136] |
| Percent Identity: | 59.26 % |
| Parental protein coverage: | 51.27 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AEEEPSGISKLPKMFHLLTESIQTNSKVVAFMKSPVGQYLDRHPFLTLTLLVFIAMSSIPVGFFLLVLVL |
| A.E......KLPK...LL.ES.QTNSKV.A..KS.VGQY.DRH..LTLTLL.FIAMS.I.V.F..L.... | |
| Retrocopy | APEYLKALQKLPKKLYLLIESNQTNSKVIALSKSLVGQYSDRH-LLTLTLLMFIAMSTIKVEFSRLLVLV |
| Parental | TSLAAFVGVIL |
| .SLA.FV.VI. | |
| Retrocopy | ASLADFVQVII |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000007187 | 1 retrocopy |
retro_etel_1773 ,
|
| Sarcophilus harrisii | ENSSHAG00000005768 | 1 retrocopy |