RetrogeneDB ID: | retro_etel_1353 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_251962:8098..8323(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PRRG4 | ||
| Ensembl ID: | ENSETEG00000008749 | ||
| Aliases: | None | ||
| Description: | proline rich Gla (G-carboxyglutamic acid) 4 (transmembrane) [Source:HGNC Symbol;Acc:30799] |
Retrocopy-Parental alignment summary:
>retro_etel_1353
TGCAACGAGGAGCCCAGGGAGATCTTTGTGGATGAAGATAAAACGATGACGTTTTGCCAGGAGTATACCGTTAAAGGATC
ATCACCAAAATCGGAGGGTCAGAGAGAAAAAGTGGATGCTTTCGGCCTTATGACTGGAATGATCGCTGCTGGAGTAGTGT
TGGTTATTTCTGGACTGCTTGGTTACTATATTTGTATCCCTAAATGTCAGAGACAACAATCTTCC
ORF - retro_etel_1353 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 51.01 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | CNYEEAREVFVDEDKTMKFWQEYTIQGPSPKSEDHGEKVDAFGLLIGLIAAGVFFIISGLLCYYICIPKC |
| CN.EE.RE.FVDEDKTM.F.QEYT..G.SPKSE...EKVDAFGL..G.IAAGV...ISGLL.YYICIPKC | |
| Retrocopy | CN-EEPREIFVDEDKTMTFCQEYTVKGSSPKSEGQREKVDAFGLMTGMIAAGVVLVISGLLGYYICIPKC |
| Parental | RRQQSS |
| .RQQSS | |
| Retrocopy | QRQQSS |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Echinops telfairi was not studied using RNA-Seq expression data.
Echinops telfairi was not studied using ChIP-Seq data.
Echinops telfairi was not studied using EST data.
Echinops telfairi was not studied using FANTOM5 data.
retro_etel_1353 was not experimentally validated.
Retrocopy orthology:
Echinops telfairi does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 1 retrocopy.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000008749 | 1 retrocopy |
retro_etel_1353 ,
|