RetrogeneDB ID: | retro_eeur_367 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_272061:13968..14196(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS10 | ||
| Ensembl ID: | ENSEEUG00000003376 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S10 [Source:HGNC Symbol;Acc:10383] |
| Percent Identity: | 66.23 % |
| Parental protein coverage: | 50.66 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | IQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARFTRGEADRDTYRRSAVPPGADKKAEAGAG |
| ..Y.R.YL..P....P.T........GRP.PKGLEGERPARFT.GEADRDTYRRS.V.PG..KKAEAGAG | |
| Retrocopy | VSYQRGYL-VPLRLPPSTP*DCAWNPGRPWPKGLEGERPARFTGGEADRDTYRRSSVIPGVNKKAEAGAG |
| Parental | SATEFQF |
| SA.EFQF | |
| Retrocopy | SAAEFQF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 34 .97 RPM |
| SRP017611_kidney | 0 .00 RPM | 97 .52 RPM |
| SRP017611_liver | 0 .00 RPM | 69 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Erinaceus europaeus | ENSEEUG00000003376 | 2 retrocopies |
retro_eeur_367 , retro_eeur_647,
|
| Latimeria chalumnae | ENSLACG00000017219 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000008539 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000013929 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000016516 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000000731 | 3 retrocopies |