RetrogeneDB ID: | retro_drer_34 | ||
Retrocopy location | Organism: | Zebrafish (Danio rerio) | |
| Coordinates: | 5:7856767..7856936(+) | ||
| Located in intron of: | ENSDARG00000042909 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CABZ01062563.1 | ||
| Ensembl ID: | ENSDARG00000086035 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.33 % |
| Parental protein coverage: | 56.86 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | SIHPSIHAILLPSVCLLFHPSIHPSIHPS-IHPSIHPFIHPSIYPSI-PHFVYCSIHPSM |
| S.H.S..A..L.SVCL.FHPSIHPS...S.I.....PFIHPSI..S..P.F..C.I..S. | |
| Retrocopy | SVHHSSNA*YL-SVCLFFHPSIHPSVYLS<INLLFCPFIHPSIILSV<PSFI*CLISVSV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Danio rerio | ENSDARG00000086035 | 3 retrocopies |
retro_drer_25, retro_drer_34 , retro_drer_37,
|
| Danio rerio | ENSDARG00000090390 | 1 retrocopy | |
| Ficedula albicollis | ENSFALG00000013753 | 1 retrocopy |