RetrogeneDB ID: | retro_chof_668 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_133411:3286..3448(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SVIP | ||
| Ensembl ID: | ENSCHOG00000013152 | ||
| Aliases: | None | ||
| Description: | small VCP/p97-interacting protein [Source:HGNC Symbol;Acc:25238] |
| Percent Identity: | 72.22 % |
| Parental protein coverage: | 70.13 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MGLCFPCPGEAEPPSPDPEEKRAKLAEAAERRQREAASRGILDVQSVEEKRKKK |
| M.L.FPCP.EA.PP..DPEEKR...AEAA.RRQR.AAS.GILD.Q.VEEKRK.K | |
| Retrocopy | MSL*FPCPMEAKPPLLDPEEKRT*FAEAADRRQRKAASQGILDIQTVEEKRKQK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013152 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000016735 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000022838 | 1 retrocopy |