RetrogeneDB ID: | retro_chof_403 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_104342:3625..3863(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRGN | ||
| Ensembl ID: | ENSCHOG00000000448 | ||
| Aliases: | None | ||
| Description: | serglycin [Source:HGNC Symbol;Acc:9361] |
| Percent Identity: | 72.5 % |
| Parental protein coverage: | 51.63 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | ALSILIGESSVQGYPMRRARYQWVRCSPDSNSANCIEEKGPVFNLPPGESNRLLPPRTDSLPMKSLLNVQ |
| .L..LI.ESSVQGYPM..ARYQWV.CSPDSNSANC.EEKG.VF.LPPGESN..LP.RTD.L.M...LN.. | |
| Retrocopy | SLLLLIWESSVQGYPMQTARYQWVSCSPDSNSANCVEEKGQVFSLPPGESNSSLPTRTDPLSMTRFLNMH |
| Parental | EV-FPLSEDY |
| .V.FPLSEDY | |
| Retrocopy | DV>FPLSEDY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017969 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000448 | 9 retrocopies |
retro_chof_1085, retro_chof_1907, retro_chof_1936, retro_chof_1950, retro_chof_227, retro_chof_2572, retro_chof_403 , retro_chof_876, retro_chof_935,
|
| Dasypus novemcinctus | ENSDNOG00000006889 | 2 retrocopies |