RetrogeneDB ID: | retro_chof_147 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | GeneScaffold_3279:39356..39548(+) | ||
| Located in intron of: | ENSCHOG00000010803 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL12 | ||
| Ensembl ID: | ENSCHOG00000006732 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L12 [Source:HGNC Symbol;Acc:10302] |
| Percent Identity: | 74.24 % |
| Parental protein coverage: | 56.64 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | GDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPR-DRKKQKNIKHSGN-ITFDEIVNIAR |
| G.W....I.VKLT.QNR.A.IEVV.SASAL..KAL.EPPR..RK.QKNIKHSGN.ITFDEIVNIAR | |
| Retrocopy | GNW*LEGILVKLTLQNRPALIEVVISASALLFKAL*EPPR<SRKQQKNIKHSGN>ITFDEIVNIAR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006732 | 32 retrocopies |
retro_chof_1081, retro_chof_129, retro_chof_145, retro_chof_1469, retro_chof_147 , retro_chof_1531, retro_chof_156, retro_chof_1666, retro_chof_1724, retro_chof_1843, retro_chof_1886, retro_chof_197, retro_chof_1992, retro_chof_2080, retro_chof_2152, retro_chof_2169, retro_chof_2279, retro_chof_2318, retro_chof_249, retro_chof_2599, retro_chof_2614, retro_chof_2656, retro_chof_295, retro_chof_310, retro_chof_354, retro_chof_386, retro_chof_484, retro_chof_592, retro_chof_677, retro_chof_831, retro_chof_916, retro_chof_925,
|
| Latimeria chalumnae | ENSLACG00000015373 | 3 retrocopies | |
| Loxodonta africana | ENSLAFG00000017669 | 10 retrocopies | |
| Macropus eugenii | ENSMEUG00000007380 | 12 retrocopies | |
| Monodelphis domestica | ENSMODG00000004571 | 9 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016220 | 4 retrocopies |