RetrogeneDB ID:

retro_chof_1196

Retrocopy
location
Organism:Sloth (Choloepus hoffmanni)
Coordinates:scaffold_222614:552..865(-)
Located in intron of:None
Retrocopy
information
Ensembl ID:None
Aliases:None
Status:NOVEL
Parental gene
information
Parental gene summary:
Parental gene symbol:ARL8B
Ensembl ID:ENSCHOG00000007757
Aliases:None
Description:ADP-ribosylation factor-like 8B [Source:HGNC Symbol;Acc:25564]


Retrocopy-Parental alignment summary:






>retro_chof_1196
TCATATCAATTCAGTGTAGATATGATACCCAAGTGGGCTTCAACATGAGGAAAGAAACTAAAGGTAATGTTACAATAAAG
ACCTGGGACATAGAGGGCAACCTCGATTCCAGAGCCTGTGGGAACGGTACTGCAGAGGAATCAGTGCTATCGTTTACACA
ATAGATGCTGTAGATCTTGAAAAGAGAGAAGACTCTCAAAATGAGCTACATACTCTCCTAGATAAACCACAGTTACAAGA
AATTCCAGCACTAGTACTTGGAAACAAGAGCGATCTTCCTAATGCCTTGTAGGAGAAGCAGCTAACTGAAAAA

ORF - retro_chof_1196 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: 74.77 %
Parental protein coverage: 72.41 %
Number of stop codons detected: 1
Number of frameshifts detected 2


Retrocopy - Parental Gene Alignment:

ParentalSGQFSEDMIPT-VGFNMRKVTKGNVTIKIWDIGG-QPRFRSMWERYCRGVNAIVYMIDAADREKIEASRN
S.QFS.DMIP..VGFNMRK.TKGNVTIK.WDI.G.QPRF.S.WERYCRG..AIVY.IDA.D.EK.E.S.N
RetrocopySYQFSVDMIPK<VGFNMRKETKGNVTIKTWDIEG<QPRFQSLWERYCRGISAIVYTIDAVDLEKREDSQN
ParentalELHNLLDKPQLQGIPVLVLGNQGDLPNALEKKPLIEK
ELH.LLDKPQLQ.IP.LVLGN..DLPNAL..K.L.EK
RetrocopyELHTLLDKPQLQEIPALVLGNKSDLPNAL*EKQLTEK

Legend:
*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide






Choloepus hoffmanni was not studied using RNA-Seq expression data.
Choloepus hoffmanni was not studied using ChIP-Seq data.
Choloepus hoffmanni was not studied using EST data.
Choloepus hoffmanni was not studied using FANTOM5 data.
retro_chof_1196 was not experimentally validated.

Retrocopy orthology:
Choloepus hoffmanni does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.

Parental genes homology:
Parental genes homology involve 12 parental genes, and 21 retrocopies.

Species Parental gene accession Retrocopies number
Choloepus hoffmanni ENSCHOG000000064274 retrocopies
Choloepus hoffmanni ENSCHOG00000007757 2 retrocopies
retro_chof_1196 , retro_chof_2630,
Callithrix jacchus ENSCJAG000000158422 retrocopies
Homo sapiens ENSG000001341081 retrocopy
Gallus gallus ENSGALG000000083141 retrocopy
Gorilla gorilla ENSGGOG000000049521 retrocopy
Microcebus murinus ENSMICG000000002442 retrocopies
Mustela putorius furoENSMPUG000000170352 retrocopies
Oryctolagus cuniculus ENSOCUG000000140902 retrocopies
Pongo abelii ENSPPYG000000136941 retrocopy
Tarsius syrichta ENSTSYG000000017241 retrocopy
Vicugna pacos ENSVPAG000000121142 retrocopies



Copyright © RetrogeneDB 2014-2017