RetrogeneDB ID: | retro_cfam_1283 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 28:28114526..28114760(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EDF1 | ||
| Ensembl ID: | ENSCAFG00000019544 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 94.87 % |
| Parental protein coverage: | 52.7 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP |
| D.VTLEVGKVIQQGRQSKGLTQKDLA.KINEK.QVIADYESG.AIPNNQVLGKIERAIGLKLRGKDIGKP | |
| Retrocopy | DGVTLEVGKVIQQGRQSKGLTQKDLAMKINEKLQVIADYESGWAIPNNQVLGKIERAIGLKLRGKDIGKP |
| Parental | IEKGPRAK |
| IEKGPRAK | |
| Retrocopy | IEKGPRAK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 130 .20 RPM |
| SRP017611_brain | 0 .00 RPM | 55 .57 RPM |
| SRP017611_kidney | 0 .00 RPM | 118 .54 RPM |
| SRP017611_liver | 0 .00 RPM | 35 .89 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000013266 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000019544 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011166 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000009565 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000026812 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000015037 | 7 retrocopies | |
| Microcebus murinus | ENSMICG00000016498 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005051 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017329 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000011008 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000015092 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016272 | 4 retrocopies | |
| Sorex araneus | ENSSARG00000007191 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014060 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002668 | 2 retrocopies |