RetrogeneDB ID: | retro_cfam_1186 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 25:30325415..30325838(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1D | ||
| Ensembl ID: | ENSCAFG00000016369 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.94 % |
| Parental protein coverage: | 60.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | AKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKIT |
| ..K...AG..LPVFEH...G.DS..LTGLARGG.....LKRN...A....V..A.LQT.FVT.DEA.... | |
| Retrocopy | SSKEDAAGDPLPVFEHHRQGSDSDKLTGLARGGDNASELKRNNVTA----VGVALLQTPFVTGDEAV--- |
| Parental | NRRVNAIEHALVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVMEPA |
| N..VNA.EH..VIIPRI...LA.IITE...RER..FYRLKKIQ.KKKIL.EKSE.D..Q...AGE.MEP. | |
| Retrocopy | NGSVNATEH--VIIPRIGCALACIITEFNVRERN-FYRLKKIQKKKKILQEKSEQDVAQQKVAGEGMEPT |
| Parental | NLLAEEKDEDL |
| NLLA.EK...L | |
| Retrocopy | NLLAGEKRKNL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .13 RPM | 42 .75 RPM |
| SRP017611_brain | 0 .16 RPM | 54 .22 RPM |
| SRP017611_kidney | 0 .00 RPM | 85 .06 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .14 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008240 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000016309 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000016369 | 2 retrocopies |
retro_cfam_1186 , retro_cfam_999,
|
| Choloepus hoffmanni | ENSCHOG00000003733 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000009085 | 1 retrocopy | |
| Felis catus | ENSFCAG00000011078 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006244 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000021418 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000009896 | 5 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007002 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000015052 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000002288 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027710 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000005696 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0040377 | 1 retrocopy |