RetrogeneDB ID: | retro_btau_928 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 21:23172341..23172592(+) | ||
| Located in intron of: | ENSBTAG00000015909 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HMGN1 | ||
| Ensembl ID: | ENSBTAG00000018768 | ||
| Aliases: | None | ||
| Description: | Non-histone chromosomal protein HMG-14 [Source:UniProtKB/Swiss-Prot;Acc:P02316] |
| Percent Identity: | 72.94 % |
| Parental protein coverage: | 82.18 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KRRSARLSA-KPAPAKVETKPKKAAGKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKNEE |
| .RRS.R....KPAPAKVE.KPKK..GKDKSSD..VQTKGKR.AKGKQ.EVANQETKE.L.A.NGET.NEE | |
| Retrocopy | QRRSTRGDRPKPAPAKVEMKPKKVVGKDKSSDR*VQTKGKREAKGKQVEVANQETKENLLAKNGETENEE |
| Parental | S-PASDEAEEKEAKS |
| S.P.SDEAEE....S | |
| Retrocopy | S<PTSDEAEEAKSDS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .07 RPM | 73 .54 RPM |
| ERP005899_muscle | 0 .16 RPM | 132 .66 RPM |
| SRP017611_brain | 0 .00 RPM | 40 .38 RPM |
| SRP017611_kidney | 0 .00 RPM | 103 .96 RPM |
| SRP017611_liver | 0 .00 RPM | 47 .04 RPM |
| SRP030211_testis | 0 .01 RPM | 89 .62 RPM |