RetrogeneDB ID: | retro_bole_65 | ||
Retrocopy location | Organism: | Brassica oleracea | |
| Coordinates: | C8:27376557..27376767(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | Bo1g024160 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_bole_65
GAACCTACACTGAGGTTCACATCAGGGGGAGTAGTGCGTGTTGTACTCTTTTTCCTTCATCATGGTTTTGTCCCACTGGG
TTTTCCTGATAAGGTTTTAATGAGGCAACATGAAGCGTACTACAGATCCTGTATGGTTATGGCATCCAAGGGGGAGTGTT
ATAAATCATGGAGTGGATTGCCATTAACCAAGACAAGAGTAGAAAGCCCG
ORF - retro_bole_65 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 52.05 % |
| Parental protein coverage: | 59.35 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | KPPLRSTSGGVVRVVLFFLHHGFVPLGFPDKLADVVKHFSAKYGKDFVSAAVGLQSDSGVSRLLVDKLSV |
| .P.LR.TSGGVVRVVLFFLHHGFVPLGFPDK.........A.Y....V.A..G.......S.L...K..V | |
| Retrocopy | EPTLRFTSGGVVRVVLFFLHHGFVPLGFPDKV--LMRQHEAYYRSCMVMASKG-ECYKSWSGLPLTKTRV |
| Parental | KAP |
| ..P | |
| Retrocopy | ESP |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Brassica oleracea was not studied using RNA-Seq expression data.
Brassica oleracea was not studied using ChIP-Seq data.
Brassica oleracea was not studied using EST data.
Brassica oleracea was not studied using FANTOM5 data.
retro_bole_65 was not experimentally validated.
Retrocopy orthology:
Brassica oleracea does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 3 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Brassica oleracea | Bo1g024160 | 3 retrocopies |
retro_bole_39, retro_bole_65 , retro_bole_69,
|