RetrogeneDB ID: | retro_acar_129 | ||
Retrocopy location | Organism: | Anole lizard (Anolis carolinensis) | |
| Coordinates: | 4:14821610..14821910(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPD1 | ||
| Ensembl ID: | ENSACAG00000006364 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.0 % |
| Parental protein coverage: | 84.03 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVE |
| V.IELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNRE.V.LETL.IRGNNI.YFILPDSL.LDTLLVDVE | |
| Retrocopy | VSIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREHVHLETLNIRGNNISYFILPDSLLLDTLLVDVE |
| Parental | PKVKSKKREAVAGRGRGRGRGRGRGRGRGR |
| PKVKSKKR.AVA.RGRGRG...G.GR...R | |
| Retrocopy | PKVKSKKRKAVA*RGRGRGKRHGQGRAGPR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP009831_adrenal | 0 .00 RPM | 50 .91 RPM |
| SRP009831_brain | 0 .00 RPM | 43 .32 RPM |
| SRP009831_dewlap | 0 .00 RPM | 69 .86 RPM |
| SRP009831_embryo | 0 .00 RPM | 171 .19 RPM |
| SRP009831_heart | 0 .00 RPM | 21 .01 RPM |
| SRP009831_liver | 0 .00 RPM | 27 .45 RPM |
| SRP009831_lung | 0 .00 RPM | 13 .80 RPM |
| SRP009831_ovary | 0 .00 RPM | 69 .49 RPM |
| SRP009831_skeletal_muscle | 0 .00 RPM | 7 .47 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000006364 | 1 retrocopy |
retro_acar_129 ,
|
| Bos taurus | ENSBTAG00000008292 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000018247 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018773 | 4 retrocopies | |
| Felis catus | ENSFCAG00000012352 | 1 retrocopy | |
| Homo sapiens | ENSG00000167088 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000003992 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000005567 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000002477 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023761 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025874 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000009909 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000005511 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013714 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000011791 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002654 | 2 retrocopies |